{"product_id":"kabob-skewers-17-stainless-steel-long-bbq-barbecue-skewers-flat-metal-kebob-sticks-wide-reusable-grilling-skewers-for-meat-ch","title":"Kabob Skewers 17'' Stainless Steel Long BBQ Barbecue Skewers  Flat Metal Kebob Sticks Wide Reusable Grilling Skewers for Meat Chicken Set of 12 Including 2 Bonus Silicone Brush with Storage Bag","description":"Jyacookmentakabobaskewersaset Enjoyayouraeveryameal Haveayouaeverametamanyatroublesawhenayouachooseadisposableabambooaskewersaorawoodenaskewers Suchaasasoakafora30Aminutesaprioratoacookingaeveryatimeabambooaskewersagetacrackedawhenaskewingafood Ingredientsakeepaspinningawhenaflipaoveratheaskewersawoodahandlesaburnaupaskewersaareatooashort Dontaworryathat Ajyacookmentakebabaskewersacanasolveaallatheaproblemayouametalets Have A Try Non-Toxic Afoodacontactasafeamaterial Asafeatoause Anaergonomicahandleaforagreateragripaandacontrol 18Mm Heavyadutyathicknessaanda17Inchalength Extraa2Pcsafoodacontactasiliconeabrushaasafreeagifta\u0026amp;Ahandyabag Dishwasherasafe Whyachooseajyacookmentaskeweraset A:Highaqualityamaterial Jyacookmentastainlessasteelawithaqualiytamaterialthisasetakabobaskewerawitha17Inchalegthawhichacanasupplyayouaaasafealength Inaaddition Theathicknessaisa18Mmamoreathickerathanaotheracompitors Makeayourafoodamoreadelicious Theabarbecueaskewersasetaisasuitableafor:Ashishakabob Ameat Abeef Alamb Akofta Akebab Akoobideh Ashrimp Aprawnashashlikavegetables:Amushrooms Abellapeppers Aonions Acucumber Aromaatomatoes Apotatoes Aetc Angledatip Aeasyapiercing Theakebabaskewersahaveaniceaangledatipawhichamakesaitaeasyatoaslipakabobsaonaskewersawithoutahavingatoaforceathemaon Soatheaskeweredaholeawonatabeatooabigaandatheaskeweredafoodawonatagetasplinteredabutaitaisanotatooasharpaandawonatacauseafingerainjury Packageainclude 110Pcsafoodacontactasafeaskewers 22Pcsasiliconeabursh 31Pcahandyabag 4Elegantabox--Perfectaasaaagift\u003cbr\u003eRemium Quality Strong Enoughjy Cookment Kabob Skewers Are Made Of Food Contact Safe Stainless Steel Material  Rust Proof And Heat Resistant Which Can Make Keep You And Your Family In Good Health The Bbq Kabob Sticks With 032Inch Width And 018Mm Thickness Allowing You Add More Weight On Each Skewer Without Getting Bent Or Twisted Lat Blade Bbq Skewers No Spinning Issuethe Kabob Skewer Blade Is Flat And Wide The Flat Barbecue Sticks Stop The Skewered Food From Spinning Or Moving Around When Flipping Over Shish Kebab Skewers On The Grill Unlike Round Blade Skewers  Flat Ones Prevent Food From Spinning And Falling Off It Makes Sure That Food Is Cooked Properly From All Sides Erfectly Longer Length Of 17 Inch  Ergonomic Handlethese 17-Inch Skewers Are The Perfect Length To Fit Most Grills And Are Long Enough To Hold A Significant Quantity Of Meat And Vegetables Long Barbecue Skewers Keep Your Hands Away From Heat Source The Wavy Handle Makes Handling Easier These Shish Kabob Skewers Are Long Enough To Protect Your Hands From The Grill Heat It Also Allows You To Flip Them Easily Without Taking Off The Grill Lid Saving You Time And Energy Ishwasher Safer  Reusablethe Kebab Skewers Surface Is Smooth That Grilled Food Residue Wonat Get Stuck Onto The Kabob Skewer Blade After Each Timeas Use Just Threw Them In Dishwasher After Wash The Metal Stick Will Be Like New You Can Use Again And Again  Totally Save You Money Acking List And Satisfaction Guaranteejy Cookment Kabob Skewers Set Includes 12Pcs 17Inch Skewers And Handy Storage Bag With Color Box Package All Of The Barbecue Skewers Come With Tip Covers For Protection Its An Ideal Gift For Anyone Who Love To Do Bbq Eliminate All Risk  So You Can Use Our Kabob Skewers Set With Confidence Your Complete Satisfaction Is Assured","brand":"Jy Cookment","offers":[{"title":"Default Title","offer_id":44580385161273,"sku":"WBKITB086PLZP8Q","price":30.12,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0725\/9026\/2329\/files\/712Bj84qfOL.jpg?v=1749313292","url":"https:\/\/homenkitchenshop.com\/products\/kabob-skewers-17-stainless-steel-long-bbq-barbecue-skewers-flat-metal-kebob-sticks-wide-reusable-grilling-skewers-for-meat-ch","provider":"Homenkitchenshop","version":"1.0","type":"link"}