What are the dimensions of the Kabob Skewers?

The Kabob Skewers are 17 inches long, providing ample space for grilling a variety of meats and vegetables.

What material are the skewers made from?

These skewers are made from high-quality stainless steel, which ensures durability and resistance to rust.

How many skewers are included in the set?

The set includes a total of 12 skewers, along with 2 bonus silicone brushes for easy basting.

Can these skewers be reused?

Yes, these skewers are reusable, making them an eco-friendly option for grilling.

Are the skewers safe to use on a grill?

Absolutely, the stainless steel material is safe for use on all types of grills, including charcoal and gas.

Do the skewers come with a storage bag?

Yes, the skewers come with a convenient storage bag, making it easy to keep them organized and transport them.

What types of food can I use these skewers for?

These skewers are ideal for grilling meats, chicken, vegetables, and even fruits, making them versatile for various recipes.

How do I clean the skewers after use?

To clean the skewers, simply wash them with warm soapy water or place them in the dishwasher for easy cleaning.

Do the skewers have any special features?

The flat design of the skewers helps to prevent food from spinning, ensuring even cooking and easy handling.

Are the silicone brushes included in the set useful?

Yes, the included silicone brushes are great for basting your food with marinades or sauces during grilling.

Kabob Skewers 17'' Stainless Steel Long Bbq Barbecue Skewers, Flat Metal Kebob Sticks Wide Reusable Grilling Skewers For Meat Ch

Kabob Skewers 17'' Stainless Steel Long BBQ Barbecue Skewers Flat Metal Kebob Sticks Wide Reusable Grilling Skewers for Meat Chicken Set of 12 Including 2 Bonus Silicone Brush with Storage Bag

Kabob Skewers 17'' Stainless Steel Long BBQ Barbecue Skewers Flat Metal Kebob Sticks Wide Reusable Grilling Skewers for Meat Chicken Set of 12 Including 2 Bonus Silicone Brush with Storage Bag

Regular price $30.12

Hurrify, 5 item(s) left in stock!

Wishlist

Brand: Jy Cookment

Type: Kitchen & Dining,Outdoor Cooking,Outdoor Cooking Tools & Accessories

Sku: WBKITB086PLZP8Q

Available : Instock

Sold by HomeNKitchenShop, an authorized reseller.

Returns accepted within 30 days | support@homenkitchenshop.com

✓ Verified

Shipping Information

Free Standard Shipping — United States only
Processing Time: 1–3 business days
Estimated Delivery: 3–5 business days after dispatch
Carefully packed to keep your home & kitchen items safe during transit
Tracking number sent via email once dispatched
Orders over $250 require signature upon delivery. Taxes calculated at checkout.

Returns & Refund

Returns accepted within 30 days of delivery.

Damaged or Defective Item

Free return shipping + replacement or full refund

Wrong Item Received

Free return shipping + replacement or full refund

Change of Mind

Return shipping at customer's expense · Item must be unused, unwashed & in original packaging

All returns require a Return Authorization (RA) number before sending.

To initiate a return, contact us:

support@homenkitchenshop.com +1 832-730-5801

Safety & Compliance

Some products sold on this website may expose you to chemicals known to the State of California to cause cancer, birth defects, or other reproductive harm.

www.P65Warnings.ca.gov

Always follow manufacturer instructions for use, cleaning, and maximum temperature ratings. Do not use cookware or utensils that are cracked, chipped, or damaged.

Keep sharp kitchen tools out of reach of children. Use heat-resistant gloves when handling hot items.

Colors and finishes may vary slightly from product images due to screen settings and natural material differences. Follow care instructions to maintain product quality and longevity.

Not all products are suitable for outdoor use unless explicitly stated.

Secure payment

Guarantee safe checkout

Kabob Skewers 17'' Stainless Steel Long BBQ Barbecue Skewers Flat Metal Kebob Sticks Wide Reusable Grilling Skewers for Meat Chicken Set of 12 Including 2 Bonus Silicone Brush with Storage Bag

$30.12

Description

Jyacookmentakabobaskewersaset Enjoyayouraeveryameal Haveayouaeverametamanyatroublesawhenayouachooseadisposableabambooaskewersaorawoodenaskewers Suchaasasoakafora30Aminutesaprioratoacookingaeveryatimeabambooaskewersagetacrackedawhenaskewingafood Ingredientsakeepaspinningawhenaflipaoveratheaskewersawoodahandlesaburnaupaskewersaareatooashort Dontaworryathat Ajyacookmentakebabaskewersacanasolveaallatheaproblemayouametalets Have A Try Non-Toxic Afoodacontactasafeamaterial Asafeatoause Anaergonomicahandleaforagreateragripaandacontrol 18Mm Heavyadutyathicknessaanda17Inchalength Extraa2Pcsafoodacontactasiliconeabrushaasafreeagifta&Ahandyabag Dishwasherasafe Whyachooseajyacookmentaskeweraset A:Highaqualityamaterial Jyacookmentastainlessasteelawithaqualiytamaterialthisasetakabobaskewerawitha17Inchalegthawhichacanasupplyayouaaasafealength Inaaddition Theathicknessaisa18Mmamoreathickerathanaotheracompitors Makeayourafoodamoreadelicious Theabarbecueaskewersasetaisasuitableafor:Ashishakabob Ameat Abeef Alamb Akofta Akebab Akoobideh Ashrimp Aprawnashashlikavegetables:Amushrooms Abellapeppers Aonions Acucumber Aromaatomatoes Apotatoes Aetc Angledatip Aeasyapiercing Theakebabaskewersahaveaniceaangledatipawhichamakesaitaeasyatoaslipakabobsaonaskewersawithoutahavingatoaforceathemaon Soatheaskeweredaholeawonatabeatooabigaandatheaskeweredafoodawonatagetasplinteredabutaitaisanotatooasharpaandawonatacauseafingerainjury Packageainclude 110Pcsafoodacontactasafeaskewers 22Pcsasiliconeabursh 31Pcahandyabag 4Elegantabox--Perfectaasaaagift
Remium Quality Strong Enoughjy Cookment Kabob Skewers Are Made Of Food Contact Safe Stainless Steel Material Rust Proof And Heat Resistant Which Can Make Keep You And Your Family In Good Health The Bbq Kabob Sticks With 032Inch Width And 018Mm Thickness Allowing You Add More Weight On Each Skewer Without Getting Bent Or Twisted Lat Blade Bbq Skewers No Spinning Issuethe Kabob Skewer Blade Is Flat And Wide The Flat Barbecue Sticks Stop The Skewered Food From Spinning Or Moving Around When Flipping Over Shish Kebab Skewers On The Grill Unlike Round Blade Skewers Flat Ones Prevent Food From Spinning And Falling Off It Makes Sure That Food Is Cooked Properly From All Sides Erfectly Longer Length Of 17 Inch Ergonomic Handlethese 17-Inch Skewers Are The Perfect Length To Fit Most Grills And Are Long Enough To Hold A Significant Quantity Of Meat And Vegetables Long Barbecue Skewers Keep Your Hands Away From Heat Source The Wavy Handle Makes Handling Easier These Shish Kabob Skewers Are Long Enough To Protect Your Hands From The Grill Heat It Also Allows You To Flip Them Easily Without Taking Off The Grill Lid Saving You Time And Energy Ishwasher Safer Reusablethe Kebab Skewers Surface Is Smooth That Grilled Food Residue Wonat Get Stuck Onto The Kabob Skewer Blade After Each Timeas Use Just Threw Them In Dishwasher After Wash The Metal Stick Will Be Like New You Can Use Again And Again Totally Save You Money Acking List And Satisfaction Guaranteejy Cookment Kabob Skewers Set Includes 12Pcs 17Inch Skewers And Handy Storage Bag With Color Box Package All Of The Barbecue Skewers Come With Tip Covers For Protection Its An Ideal Gift For Anyone Who Love To Do Bbq Eliminate All Risk So You Can Use Our Kabob Skewers Set With Confidence Your Complete Satisfaction Is Assured

Frequently Asked Questions

Q: What are the dimensions of the Kabob Skewers? A: The Kabob Skewers are 17 inches long, providing ample space for grilling a variety of meats and vegetables.
Q: What material are the skewers made from? A: These skewers are made from high-quality stainless steel, which ensures durability and resistance to rust.
Q: How many skewers are included in the set? A: The set includes a total of 12 skewers, along with 2 bonus silicone brushes for easy basting.
Q: Can these skewers be reused? A: Yes, these skewers are reusable, making them an eco-friendly option for grilling.
Q: Are the skewers safe to use on a grill? A: Absolutely, the stainless steel material is safe for use on all types of grills, including charcoal and gas.
Q: Do the skewers come with a storage bag? A: Yes, the skewers come with a convenient storage bag, making it easy to keep them organized and transport them.
Q: What types of food can I use these skewers for? A: These skewers are ideal for grilling meats, chicken, vegetables, and even fruits, making them versatile for various recipes.
Q: How do I clean the skewers after use? A: To clean the skewers, simply wash them with warm soapy water or place them in the dishwasher for easy cleaning.
Q: Do the skewers have any special features? A: The flat design of the skewers helps to prevent food from spinning, ensuring even cooking and easy handling.
Q: Are the silicone brushes included in the set useful? A: Yes, the included silicone brushes are great for basting your food with marinades or sauces during grilling.